PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC06G06310.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRF
Protein Properties Length: 292aa    MW: 31692.3 Da    PI: 8.3851
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC06G06310.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.62.6e-2486129144
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                      d+epgrCrRtDGKkWRCsr++++ +k+CE+H+hrg++rsrk++e
  OPUNC06G06310.1  86 DPEPGRCRRTDGKKWRCSREAYGESKYCEKHMHRGKNRSRKPVE 129
                      79***************************************997 PP

2QLQ62.79.7e-221246236
              QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                      FTa+Q+q+L++Q+l+yKy+aa++PvPp+Ll++++
  OPUNC06G06310.1 12 LFTATQWQELEHQALIYKYMAAGAPVPPDLLLHLR 46
                     5******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.4E-101147IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.0391247IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088808.6E-161345IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.71486130IPR014977WRC domain
PfamPF088791.4E-1987129IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MMMAGGGSGR CLFTATQWQE LEHQALIYKY MAAGAPVPPD LLLHLRHRAA AAGDVDTVPS  60
LAFPPHHLGW GCYGAAAAQY GRRVEDPEPG RCRRTDGKKW RCSREAYGES KYCEKHMHRG  120
KNRSRKPVEM APSAAAAGGG VYRPSALSIS PPAHDAPLQL HLDSFHASTS PPPSYHRYAH  180
TSAPLFPTSG GYGGWSSSKE HCLSLGGATD LSMDKPADHH HDATSATTTT TTEKPLRRFF  240
DEWPRSDDRR TPWDGTQLSI SIPTAASSPD LAIAGAAASR YHNNGDHLRM SE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8361980.0CT836198.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA059E01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641768.11e-169PREDICTED: growth-regulating factor 2
SwissprotQ6AWY71e-171GRF2_ORYSJ; Growth-regulating factor 2
TrEMBLA0A0E0L9350.0A0A0E0L935_ORYPU; Uncharacterized protein
STRINGORGLA06G0059900.11e-179(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP139922527
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.13e-43growth-regulating factor 5